Protein Description: protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Gene Name: PTPN5
Alternative Gene Name: PTPSTEP, STEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030854: 91%, ENSRNOG00000013981: 92%
Entrez Gene ID: 84867
Uniprot ID: P54829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTPN5
Alternative Gene Name: PTPSTEP, STEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030854: 91%, ENSRNOG00000013981: 92%
Entrez Gene ID: 84867
Uniprot ID: P54829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY |
| Documents & Links for Anti PTPN5 pAb (ATL-HPA072091) | |
| Datasheet | Anti PTPN5 pAb (ATL-HPA072091) Datasheet (External Link) |
| Vendor Page | Anti PTPN5 pAb (ATL-HPA072091) at Atlas |
| Documents & Links for Anti PTPN5 pAb (ATL-HPA072091) | |
| Datasheet | Anti PTPN5 pAb (ATL-HPA072091) Datasheet (External Link) |
| Vendor Page | Anti PTPN5 pAb (ATL-HPA072091) |