Anti PTPN20 pAb (ATL-HPA069148 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA069148-25

• 

Product Description

Protein Description: protein tyrosine phosphatase, non-receptor type 20
Gene Name: PTPN20
Alternative Gene Name: bA142I17.1, bA42B19.1, CT126, DKFZP566K0524, PTPN20A, PTPN20B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021940: 71%, ENSRNOG00000020203: 76%
Entrez Gene ID: 26095
Uniprot ID: Q4JDL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDH
• Gene Sequence: MITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDH
• Gene ID - Mouse: ENSMUSG00000021940
• Gene ID - Rat: ENSRNOG00000020203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.