Protein Description: pleiotrophin
Gene Name: PTN
Alternative Gene Name: HBGF8, HBNF, NEGF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029838: 98%, ENSRNOG00000011946: 98%
Entrez Gene ID: 5764
Uniprot ID: P21246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTN
Alternative Gene Name: HBGF8, HBNF, NEGF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029838: 98%, ENSRNOG00000011946: 98%
Entrez Gene ID: 5764
Uniprot ID: P21246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK |
Documents & Links for Anti PTN pAb (ATL-HPA073913) | |
Datasheet | Anti PTN pAb (ATL-HPA073913) Datasheet (External Link) |
Vendor Page | Anti PTN pAb (ATL-HPA073913) at Atlas |
Documents & Links for Anti PTN pAb (ATL-HPA073913) | |
Datasheet | Anti PTN pAb (ATL-HPA073913) Datasheet (External Link) |
Vendor Page | Anti PTN pAb (ATL-HPA073913) |