Protein Description: parathyroid hormone 1 receptor
Gene Name: PTH1R
Alternative Gene Name: PTHR, PTHR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032492: 79%, ENSRNOG00000020948: 80%
Entrez Gene ID: 5745
Uniprot ID: Q03431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTH1R
Alternative Gene Name: PTHR, PTHR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032492: 79%, ENSRNOG00000020948: 80%
Entrez Gene ID: 5745
Uniprot ID: Q03431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDH |
Documents & Links for Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) | |
Datasheet | Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) at Atlas |
Documents & Links for Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) | |
Datasheet | Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation) |