Anti PTH1R pAb (ATL-HPA075879 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA075879-25

• 

Product Description

Protein Description: parathyroid hormone 1 receptor
Gene Name: PTH1R
Alternative Gene Name: PTHR, PTHR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032492: 79%, ENSRNOG00000020948: 80%
Entrez Gene ID: 5745
Uniprot ID: Q03431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDH
• Gene Sequence: FLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDH
• Gene ID - Mouse: ENSMUSG00000032492
• Gene ID - Rat: ENSRNOG00000020948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.