Anti PTCH1 pAb (ATL-HPA075072)

Atlas Antibodies

Catalog No: ATL-HPA075072-25

• 

Product Description

Protein Description: patched 1
Gene Name: PTCH1
Alternative Gene Name: BCNS, NBCCS, PTCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021466: 89%, ENSRNOG00000019354: 89%
Entrez Gene ID: 5727
Uniprot ID: Q13635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS
• Gene Sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS
• Gene ID - Mouse: ENSMUSG00000021466
• Gene ID - Rat: ENSRNOG00000019354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.