Description
Product Description
Protein Description: patched 1
Gene Name: PTCH1
Alternative Gene Name: BCNS, NBCCS, PTCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021466: 89%, ENSRNOG00000019354: 89%
Entrez Gene ID: 5727
Uniprot ID: Q13635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTCH1
Alternative Gene Name: BCNS, NBCCS, PTCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021466: 89%, ENSRNOG00000019354: 89%
Entrez Gene ID: 5727
Uniprot ID: Q13635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS |
Gene Sequence | SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS |
Gene ID - Mouse | ENSMUSG00000021466 |
Gene ID - Rat | ENSRNOG00000019354 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PTCH1 pAb (ATL-HPA075072) | |
Datasheet | Anti PTCH1 pAb (ATL-HPA075072) Datasheet (External Link) |
Vendor Page | Anti PTCH1 pAb (ATL-HPA075072) at Atlas Antibodies |
Documents & Links for Anti PTCH1 pAb (ATL-HPA075072) | |
Datasheet | Anti PTCH1 pAb (ATL-HPA075072) Datasheet (External Link) |
Vendor Page | Anti PTCH1 pAb (ATL-HPA075072) |