Anti PSMG4 pAb (ATL-HPA074376)

Atlas Antibodies

Catalog No: ATL-HPA074376-25

• 

Product Description

Protein Description: proteasome assembly chaperone 4
Gene Name: PSMG4
Alternative Gene Name: C6orf86, PAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071451: 95%, ENSRNOG00000039265: 95%
Entrez Gene ID: 389362
Uniprot ID: Q5JS54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT
• Gene Sequence: DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT
• Gene ID - Mouse: ENSMUSG00000071451
• Gene ID - Rat: ENSRNOG00000039265
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.