Protein Description: proteasome assembly chaperone 4
Gene Name: PSMG4
Alternative Gene Name: C6orf86, PAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071451: 95%, ENSRNOG00000039265: 95%
Entrez Gene ID: 389362
Uniprot ID: Q5JS54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMG4
Alternative Gene Name: C6orf86, PAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071451: 95%, ENSRNOG00000039265: 95%
Entrez Gene ID: 389362
Uniprot ID: Q5JS54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT |
| Documents & Links for Anti PSMG4 pAb (ATL-HPA074376) | |
| Datasheet | Anti PSMG4 pAb (ATL-HPA074376) Datasheet (External Link) |
| Vendor Page | Anti PSMG4 pAb (ATL-HPA074376) at Atlas |
| Documents & Links for Anti PSMG4 pAb (ATL-HPA074376) | |
| Datasheet | Anti PSMG4 pAb (ATL-HPA074376) Datasheet (External Link) |
| Vendor Page | Anti PSMG4 pAb (ATL-HPA074376) |