Protein Description: proteasome (prosome, macropain) assembly chaperone 1
Gene Name: PSMG1
Alternative Gene Name: c21-LRP, DSCR2, LRPC21, PAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022913: 77%, ENSRNOG00000001643: 75%
Entrez Gene ID: 8624
Uniprot ID: O95456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMG1
Alternative Gene Name: c21-LRP, DSCR2, LRPC21, PAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022913: 77%, ENSRNOG00000001643: 75%
Entrez Gene ID: 8624
Uniprot ID: O95456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | THLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPF |
| Documents & Links for Anti PSMG1 pAb (ATL-HPA070225) | |
| Datasheet | Anti PSMG1 pAb (ATL-HPA070225) Datasheet (External Link) |
| Vendor Page | Anti PSMG1 pAb (ATL-HPA070225) at Atlas |
| Documents & Links for Anti PSMG1 pAb (ATL-HPA070225) | |
| Datasheet | Anti PSMG1 pAb (ATL-HPA070225) Datasheet (External Link) |
| Vendor Page | Anti PSMG1 pAb (ATL-HPA070225) |