Anti PSMG1 pAb (ATL-HPA057193)

Catalog No:
ATL-HPA057193-25
$447.00

Description

Product Description

Protein Description: proteasome (prosome, macropain) assembly chaperone 1
Gene Name: PSMG1
Alternative Gene Name: c21-LRP, DSCR2, LRPC21, PAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022913: 91%, ENSRNOG00000001643: 87%
Entrez Gene ID: 8624
Uniprot ID: O95456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Gene Sequence CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Gene ID - Mouse ENSMUSG00000022913
Gene ID - Rat ENSRNOG00000001643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PSMG1 pAb (ATL-HPA057193)
Datasheet Anti PSMG1 pAb (ATL-HPA057193) Datasheet (External Link)
Vendor Page Anti PSMG1 pAb (ATL-HPA057193) at Atlas Antibodies

Documents & Links for Anti PSMG1 pAb (ATL-HPA057193)
Datasheet Anti PSMG1 pAb (ATL-HPA057193) Datasheet (External Link)
Vendor Page Anti PSMG1 pAb (ATL-HPA057193)

Product Description

Protein Description: proteasome (prosome, macropain) assembly chaperone 1
Gene Name: PSMG1
Alternative Gene Name: c21-LRP, DSCR2, LRPC21, PAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022913: 91%, ENSRNOG00000001643: 87%
Entrez Gene ID: 8624
Uniprot ID: O95456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Gene Sequence CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Gene ID - Mouse ENSMUSG00000022913
Gene ID - Rat ENSRNOG00000001643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PSMG1 pAb (ATL-HPA057193)
Datasheet Anti PSMG1 pAb (ATL-HPA057193) Datasheet (External Link)
Vendor Page Anti PSMG1 pAb (ATL-HPA057193) at Atlas Antibodies

Documents & Links for Anti PSMG1 pAb (ATL-HPA057193)
Datasheet Anti PSMG1 pAb (ATL-HPA057193) Datasheet (External Link)
Vendor Page Anti PSMG1 pAb (ATL-HPA057193)