Anti PSMG1 pAb (ATL-HPA057193)

Atlas Antibodies

Catalog No: ATL-HPA057193-25

• 
• 

Product Description

Protein Description: proteasome (prosome, macropain) assembly chaperone 1
Gene Name: PSMG1
Alternative Gene Name: c21-LRP, DSCR2, LRPC21, PAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022913: 91%, ENSRNOG00000001643: 87%
Entrez Gene ID: 8624
Uniprot ID: O95456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
• Gene Sequence: CCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
• Gene ID - Mouse: ENSMUSG00000022913
• Gene ID - Rat: ENSRNOG00000001643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.