Anti PSME2 pAb (ATL-HPA062661)

Atlas Antibodies

Catalog No: ATL-HPA062661-25

• 
• 

Product Description

Protein Description: proteasome activator subunit 2
Gene Name: PSME2
Alternative Gene Name: PA28beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079197: 93%, ENSRNOG00000019246: 90%
Entrez Gene ID: 5721
Uniprot ID: Q9UL46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
• Gene Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
• Gene ID - Mouse: ENSMUSG00000079197
• Gene ID - Rat: ENSRNOG00000019246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.