Anti PSMD7 pAb (ATL-HPA056069 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056069-100

• 
• 
• 

Product Description

Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
Gene Name: PSMD7
Alternative Gene Name: MOV34, P40, Rpn8, S12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039067: 100%, ENSRNOG00000014097: 100%
Entrez Gene ID: 5713
Uniprot ID: P51665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK
• Gene Sequence: IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK
• Gene ID - Mouse: ENSMUSG00000039067
• Gene ID - Rat: ENSRNOG00000014097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.