Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062363-25

• 
• 

Product Description

Protein Description: proteasome 26S subunit, non-ATPase 2
Gene Name: PSMD2
Alternative Gene Name: MGC14274, P97, Rpn1, S2, TRAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006998: 100%, ENSRNOG00000001719: 100%
Entrez Gene ID: 5708
Uniprot ID: Q13200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
• Gene Sequence: EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
• Gene ID - Mouse: ENSMUSG00000006998
• Gene ID - Rat: ENSRNOG00000001719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.