Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
Gene Name: PSMD12
Alternative Gene Name: p55, Rpn5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020720: 94%, ENSRNOG00000003117: 95%
Entrez Gene ID: 5718
Uniprot ID: O00232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMD12
Alternative Gene Name: p55, Rpn5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020720: 94%, ENSRNOG00000003117: 95%
Entrez Gene ID: 5718
Uniprot ID: O00232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH |
| Documents & Links for Anti PSMD12 pAb (ATL-HPA023119) | |
| Datasheet | Anti PSMD12 pAb (ATL-HPA023119) Datasheet (External Link) |
| Vendor Page | Anti PSMD12 pAb (ATL-HPA023119) at Atlas |
| Documents & Links for Anti PSMD12 pAb (ATL-HPA023119) | |
| Datasheet | Anti PSMD12 pAb (ATL-HPA023119) Datasheet (External Link) |
| Vendor Page | Anti PSMD12 pAb (ATL-HPA023119) |