Protein Description: proteasome 26S subunit, non-ATPase 11
Gene Name: PSMD11
Alternative Gene Name: MGC3844, p44.5, Rpn6, S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017428: 100%, ENSRNOG00000005538: 100%
Entrez Gene ID: 5717
Uniprot ID: O00231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMD11
Alternative Gene Name: MGC3844, p44.5, Rpn6, S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017428: 100%, ENSRNOG00000005538: 100%
Entrez Gene ID: 5717
Uniprot ID: O00231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY |
Documents & Links for Anti PSMD11 pAb (ATL-HPA067433) | |
Datasheet | Anti PSMD11 pAb (ATL-HPA067433) Datasheet (External Link) |
Vendor Page | Anti PSMD11 pAb (ATL-HPA067433) at Atlas |
Documents & Links for Anti PSMD11 pAb (ATL-HPA067433) | |
Datasheet | Anti PSMD11 pAb (ATL-HPA067433) Datasheet (External Link) |
Vendor Page | Anti PSMD11 pAb (ATL-HPA067433) |