Anti PSMD11 pAb (ATL-HPA067433)

Atlas Antibodies

Catalog No: ATL-HPA067433-100

• 
• 
• 

Product Description

Protein Description: proteasome 26S subunit, non-ATPase 11
Gene Name: PSMD11
Alternative Gene Name: MGC3844, p44.5, Rpn6, S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017428: 100%, ENSRNOG00000005538: 100%
Entrez Gene ID: 5717
Uniprot ID: O00231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY
• Gene Sequence: AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY
• Gene ID - Mouse: ENSMUSG00000017428
• Gene ID - Rat: ENSRNOG00000005538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.