Description
Product Description
Protein Description: proteasome 26S subunit, ATPase 5
Gene Name: PSMC5
Alternative Gene Name: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020708: 100%, ENSRNOG00000010038: 100%
Entrez Gene ID: 5705
Uniprot ID: P62195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMC5
Alternative Gene Name: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020708: 100%, ENSRNOG00000010038: 100%
Entrez Gene ID: 5705
Uniprot ID: P62195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
Gene Sequence | VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
Gene ID - Mouse | ENSMUSG00000020708 |
Gene ID - Rat | ENSRNOG00000010038 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) | |
Datasheet | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) | |
Datasheet | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) |