Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)

Catalog No:
ATL-HPA064293-25
$395.00

Description

Product Description

Protein Description: proteasome 26S subunit, ATPase 5
Gene Name: PSMC5
Alternative Gene Name: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020708: 100%, ENSRNOG00000010038: 100%
Entrez Gene ID: 5705
Uniprot ID: P62195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Gene Sequence VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Gene ID - Mouse ENSMUSG00000020708
Gene ID - Rat ENSRNOG00000010038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)
Datasheet Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)
Datasheet Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)

Product Description

Protein Description: proteasome 26S subunit, ATPase 5
Gene Name: PSMC5
Alternative Gene Name: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020708: 100%, ENSRNOG00000010038: 100%
Entrez Gene ID: 5705
Uniprot ID: P62195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Gene Sequence VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Gene ID - Mouse ENSMUSG00000020708
Gene ID - Rat ENSRNOG00000010038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)
Datasheet Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)
Datasheet Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)