Protein Description: proteasome subunit beta 6
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM |
| Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
| Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
| Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) at Atlas |
| Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
| Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
| Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) |