Anti PSMB6 pAb (ATL-HPA063656)

Atlas Antibodies

Catalog No: ATL-HPA063656-100

• 
• 

Product Description

Protein Description: proteasome subunit beta 6
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
• Gene Sequence: SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
• Gene ID - Mouse: ENSMUSG00000018286
• Gene ID - Rat: ENSRNOG00000019551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.