Anti PSMB4 pAb (ATL-HPA073499)

Atlas Antibodies

Catalog No: ATL-HPA073499-25

• 

Product Description

Protein Description: proteasome subunit beta 4
Gene Name: PSMB4
Alternative Gene Name: HN3, PROS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005779: 89%, ENSRNOG00000020979: 73%
Entrez Gene ID: 5692
Uniprot ID: P28070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA
• Gene Sequence: APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA
• Gene ID - Mouse: ENSMUSG00000005779
• Gene ID - Rat: ENSRNOG00000020979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.