Protein Description: proteasome subunit beta 4
Gene Name: PSMB4
Alternative Gene Name: HN3, PROS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005779: 89%, ENSRNOG00000020979: 73%
Entrez Gene ID: 5692
Uniprot ID: P28070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSMB4
Alternative Gene Name: HN3, PROS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005779: 89%, ENSRNOG00000020979: 73%
Entrez Gene ID: 5692
Uniprot ID: P28070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA |
| Documents & Links for Anti PSMB4 pAb (ATL-HPA073499) | |
| Datasheet | Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link) |
| Vendor Page | Anti PSMB4 pAb (ATL-HPA073499) at Atlas |
| Documents & Links for Anti PSMB4 pAb (ATL-HPA073499) | |
| Datasheet | Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link) |
| Vendor Page | Anti PSMB4 pAb (ATL-HPA073499) |