Protein Description: protease, serine, 37
Gene Name: PRSS37
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029909: 84%, ENSRNOG00000012201: 82%
Entrez Gene ID: 136242
Uniprot ID: A4D1T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRSS37
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029909: 84%, ENSRNOG00000012201: 82%
Entrez Gene ID: 136242
Uniprot ID: A4D1T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC |
| Documents & Links for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) | |
| Datasheet | Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) at Atlas |
| Documents & Links for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) | |
| Datasheet | Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) |
| Citations for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) – 1 Found |
| Shang, Xuan; Shen, Chunling; Liu, Jianbing; Tang, Lingyun; Zhang, Hongxin; Wang, Yicheng; Wu, Wenting; Chi, Jun; Zhuang, Hua; Fei, Jian; Wang, Zhugang. Serine protease PRSS55 is crucial for male mouse fertility via affecting sperm migration and sperm-egg binding. Cellular And Molecular Life Sciences : Cmls. 2018;75(23):4371-4384. PubMed |