Description
Product Description
Protein Description: proline rich 35
Gene Name: PRR35
Alternative Gene Name: C16orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 80%, ENSRNOG00000020212: 80%
Entrez Gene ID: 146325
Uniprot ID: P0CG20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR35
Alternative Gene Name: C16orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 80%, ENSRNOG00000020212: 80%
Entrez Gene ID: 146325
Uniprot ID: P0CG20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA |
Gene Sequence | EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA |
Gene ID - Mouse | ENSMUSG00000025727 |
Gene ID - Rat | ENSRNOG00000020212 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRR35 pAb (ATL-HPA069297) | |
Datasheet | Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link) |
Vendor Page | Anti PRR35 pAb (ATL-HPA069297) at Atlas Antibodies |
Documents & Links for Anti PRR35 pAb (ATL-HPA069297) | |
Datasheet | Anti PRR35 pAb (ATL-HPA069297) Datasheet (External Link) |
Vendor Page | Anti PRR35 pAb (ATL-HPA069297) |