Anti PRR35 pAb (ATL-HPA069297)

Atlas Antibodies

Catalog No: ATL-HPA069297-25

• 

Product Description

Protein Description: proline rich 35
Gene Name: PRR35
Alternative Gene Name: C16orf11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 80%, ENSRNOG00000020212: 80%
Entrez Gene ID: 146325
Uniprot ID: P0CG20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA
• Gene Sequence: EHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRA
• Gene ID - Mouse: ENSMUSG00000025727
• Gene ID - Rat: ENSRNOG00000020212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.