Protein Description: proline rich 3
Gene Name: PRR3
Alternative Gene Name: CAT56, Em:AB014077.1, Em:AB023052.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038500: 86%, ENSRNOG00000025806: 83%
Entrez Gene ID: 80742
Uniprot ID: P79522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR3
Alternative Gene Name: CAT56, Em:AB014077.1, Em:AB023052.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038500: 86%, ENSRNOG00000025806: 83%
Entrez Gene ID: 80742
Uniprot ID: P79522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRH |
Documents & Links for Anti PRR3 pAb (ATL-HPA064061) | |
Datasheet | Anti PRR3 pAb (ATL-HPA064061) Datasheet (External Link) |
Vendor Page | Anti PRR3 pAb (ATL-HPA064061) at Atlas |
Documents & Links for Anti PRR3 pAb (ATL-HPA064061) | |
Datasheet | Anti PRR3 pAb (ATL-HPA064061) Datasheet (External Link) |
Vendor Page | Anti PRR3 pAb (ATL-HPA064061) |