Anti PRR26 pAb (ATL-HPA066037)

Catalog No:
ATL-HPA066037-25
$447.00

Description

Product Description

Protein Description: proline rich 26
Gene Name: PRR26
Alternative Gene Name: C10orf108, FLJ38681
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024818: 34%, ENSRNOG00000010588: 33%
Entrez Gene ID:
Uniprot ID: Q8N8Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS
Gene Sequence SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS
Gene ID - Mouse ENSMUSG00000024818
Gene ID - Rat ENSRNOG00000010588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRR26 pAb (ATL-HPA066037)
Datasheet Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link)
Vendor Page Anti PRR26 pAb (ATL-HPA066037) at Atlas Antibodies

Documents & Links for Anti PRR26 pAb (ATL-HPA066037)
Datasheet Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link)
Vendor Page Anti PRR26 pAb (ATL-HPA066037)

Product Description

Protein Description: proline rich 26
Gene Name: PRR26
Alternative Gene Name: C10orf108, FLJ38681
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024818: 34%, ENSRNOG00000010588: 33%
Entrez Gene ID:
Uniprot ID: Q8N8Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS
Gene Sequence SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS
Gene ID - Mouse ENSMUSG00000024818
Gene ID - Rat ENSRNOG00000010588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRR26 pAb (ATL-HPA066037)
Datasheet Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link)
Vendor Page Anti PRR26 pAb (ATL-HPA066037) at Atlas Antibodies

Documents & Links for Anti PRR26 pAb (ATL-HPA066037)
Datasheet Anti PRR26 pAb (ATL-HPA066037) Datasheet (External Link)
Vendor Page Anti PRR26 pAb (ATL-HPA066037)