Description
Product Description
Protein Description: proline rich 20A
Gene Name: PRR20A
Alternative Gene Name: FLJ40296, PRR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 36%, ENSRNOG00000026675: 35%
Entrez Gene ID: 122183
Uniprot ID: P86496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR20A
Alternative Gene Name: FLJ40296, PRR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 36%, ENSRNOG00000026675: 35%
Entrez Gene ID: 122183
Uniprot ID: P86496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP |
Gene Sequence | MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQP |
Gene ID - Mouse | ENSMUSG00000029636 |
Gene ID - Rat | ENSRNOG00000026675 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRR20A pAb (ATL-HPA059485) | |
Datasheet | Anti PRR20A pAb (ATL-HPA059485) Datasheet (External Link) |
Vendor Page | Anti PRR20A pAb (ATL-HPA059485) at Atlas Antibodies |
Documents & Links for Anti PRR20A pAb (ATL-HPA059485) | |
Datasheet | Anti PRR20A pAb (ATL-HPA059485) Datasheet (External Link) |
Vendor Page | Anti PRR20A pAb (ATL-HPA059485) |