Protein Description: proline rich 19
Gene Name: PRR19
Alternative Gene Name: MGC70924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058741: 57%, ENSRNOG00000043154: 62%
Entrez Gene ID: 284338
Uniprot ID: A6NJB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR19
Alternative Gene Name: MGC70924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058741: 57%, ENSRNOG00000043154: 62%
Entrez Gene ID: 284338
Uniprot ID: A6NJB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER |
| Documents & Links for Anti PRR19 pAb (ATL-HPA070350) | |
| Datasheet | Anti PRR19 pAb (ATL-HPA070350) Datasheet (External Link) |
| Vendor Page | Anti PRR19 pAb (ATL-HPA070350) at Atlas |
| Documents & Links for Anti PRR19 pAb (ATL-HPA070350) | |
| Datasheet | Anti PRR19 pAb (ATL-HPA070350) Datasheet (External Link) |
| Vendor Page | Anti PRR19 pAb (ATL-HPA070350) |