Anti PRR19 pAb (ATL-HPA070350)

Atlas Antibodies

Catalog No: ATL-HPA070350-25

• 

Product Description

Protein Description: proline rich 19
Gene Name: PRR19
Alternative Gene Name: MGC70924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058741: 57%, ENSRNOG00000043154: 62%
Entrez Gene ID: 284338
Uniprot ID: A6NJB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER
• Gene Sequence: DARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQER
• Gene ID - Mouse: ENSMUSG00000058741
• Gene ID - Rat: ENSRNOG00000043154
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.