Protein Description: proline rich 18
Gene Name: PRR18
Alternative Gene Name: MGC35308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055945: 75%, ENSRNOG00000024149: 73%
Entrez Gene ID: 285800
Uniprot ID: Q8N4B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR18
Alternative Gene Name: MGC35308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055945: 75%, ENSRNOG00000024149: 73%
Entrez Gene ID: 285800
Uniprot ID: Q8N4B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR |
| Documents & Links for Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) | |
| Datasheet | Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) at Atlas |
| Documents & Links for Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) | |
| Datasheet | Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation) |