Anti PRR18 pAb (ATL-HPA077250 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA077250-25

• 

Product Description

Protein Description: proline rich 18
Gene Name: PRR18
Alternative Gene Name: MGC35308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055945: 75%, ENSRNOG00000024149: 73%
Entrez Gene ID: 285800
Uniprot ID: Q8N4B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR
• Gene Sequence: CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR
• Gene ID - Mouse: ENSMUSG00000055945
• Gene ID - Rat: ENSRNOG00000024149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.