Description
Product Description
Protein Description: proline rich 14-like
Gene Name: PRR14L
Alternative Gene Name: C22orf30, MGC50372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054280: 58%, ENSRNOG00000048891: 53%
Entrez Gene ID: 253143
Uniprot ID: Q5THK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRR14L
Alternative Gene Name: C22orf30, MGC50372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054280: 58%, ENSRNOG00000048891: 53%
Entrez Gene ID: 253143
Uniprot ID: Q5THK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST |
Gene Sequence | ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST |
Gene ID - Mouse | ENSMUSG00000054280 |
Gene ID - Rat | ENSRNOG00000048891 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRR14L pAb (ATL-HPA062645) | |
Datasheet | Anti PRR14L pAb (ATL-HPA062645) Datasheet (External Link) |
Vendor Page | Anti PRR14L pAb (ATL-HPA062645) at Atlas Antibodies |
Documents & Links for Anti PRR14L pAb (ATL-HPA062645) | |
Datasheet | Anti PRR14L pAb (ATL-HPA062645) Datasheet (External Link) |
Vendor Page | Anti PRR14L pAb (ATL-HPA062645) |