Protein Description: peripherin
Gene Name: PRPH
Alternative Gene Name: NEF4, PRPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023484: 83%, ENSRNOG00000052880: 90%
Entrez Gene ID: 5630
Uniprot ID: P41219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRPH
Alternative Gene Name: NEF4, PRPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023484: 83%, ENSRNOG00000052880: 90%
Entrez Gene ID: 5630
Uniprot ID: P41219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTI |
| Documents & Links for Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) | |
| Datasheet | Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) at Atlas |
| Documents & Links for Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) | |
| Datasheet | Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRPH pAb (ATL-HPA063887 w/enhanced validation) |