Anti PRPF38A pAb (ATL-HPA058407)

Atlas Antibodies

Catalog No: ATL-HPA058407-25

• 
• 

Product Description

Protein Description: pre-mRNA processing factor 38A
Gene Name: PRPF38A
Alternative Gene Name: FLJ14936, Prp38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063800: 99%, ENSRNOG00000009451: 99%
Entrez Gene ID: 84950
Uniprot ID: Q8NAV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKD
• Gene Sequence: MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKD
• Gene ID - Mouse: ENSMUSG00000063800
• Gene ID - Rat: ENSRNOG00000009451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.