Description
Product Description
Protein Description: pre-mRNA processing factor 19
Gene Name: PRPF19
Alternative Gene Name: hPSO4, NMP200, PRP19, PSO4, UBOX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024735: 99%, ENSRNOG00000020897: 99%
Entrez Gene ID: 27339
Uniprot ID: Q9UMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRPF19
Alternative Gene Name: hPSO4, NMP200, PRP19, PSO4, UBOX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024735: 99%, ENSRNOG00000020897: 99%
Entrez Gene ID: 27339
Uniprot ID: Q9UMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV |
Gene Sequence | LQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV |
Gene ID - Mouse | ENSMUSG00000024735 |
Gene ID - Rat | ENSRNOG00000020897 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) | |
Datasheet | Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) | |
Datasheet | Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRPF19 pAb (ATL-HPA059070 w/enhanced validation) |