Anti PROSER1 pAb (ATL-HPA055687)

Atlas Antibodies

Catalog No: ATL-HPA055687-25

• 
• 

Product Description

Protein Description: proline and serine rich 1
Gene Name: PROSER1
Alternative Gene Name: bA50D16.2, C13orf23, FLJ12661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049504: 90%, ENSRNOG00000010980: 90%
Entrez Gene ID: 80209
Uniprot ID: Q86XN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM
• Gene Sequence: EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM
• Gene ID - Mouse: ENSMUSG00000049504
• Gene ID - Rat: ENSRNOG00000010980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.