Anti PRMT6 pAb (ATL-HPA059424)

Atlas Antibodies

Catalog No: ATL-HPA059424-25

• 
• 

Product Description

Protein Description: protein arginine methyltransferase 6
Gene Name: PRMT6
Alternative Gene Name: FLJ10559, HRMT1L6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049300: 91%, ENSRNOG00000048996: 95%
Entrez Gene ID: 55170
Uniprot ID: Q96LA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
• Gene Sequence: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
• Gene ID - Mouse: ENSMUSG00000049300
• Gene ID - Rat: ENSRNOG00000048996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.