Anti PRMT6 pAb (ATL-HPA059424)

Catalog No:
ATL-HPA059424-25
$447.00

Description

Product Description

Protein Description: protein arginine methyltransferase 6
Gene Name: PRMT6
Alternative Gene Name: FLJ10559, HRMT1L6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049300: 91%, ENSRNOG00000048996: 95%
Entrez Gene ID: 55170
Uniprot ID: Q96LA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
Gene Sequence WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
Gene ID - Mouse ENSMUSG00000049300
Gene ID - Rat ENSRNOG00000048996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRMT6 pAb (ATL-HPA059424)
Datasheet Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link)
Vendor Page Anti PRMT6 pAb (ATL-HPA059424) at Atlas Antibodies

Documents & Links for Anti PRMT6 pAb (ATL-HPA059424)
Datasheet Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link)
Vendor Page Anti PRMT6 pAb (ATL-HPA059424)

Product Description

Protein Description: protein arginine methyltransferase 6
Gene Name: PRMT6
Alternative Gene Name: FLJ10559, HRMT1L6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049300: 91%, ENSRNOG00000048996: 95%
Entrez Gene ID: 55170
Uniprot ID: Q96LA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
Gene Sequence WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
Gene ID - Mouse ENSMUSG00000049300
Gene ID - Rat ENSRNOG00000048996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRMT6 pAb (ATL-HPA059424)
Datasheet Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link)
Vendor Page Anti PRMT6 pAb (ATL-HPA059424) at Atlas Antibodies

Documents & Links for Anti PRMT6 pAb (ATL-HPA059424)
Datasheet Anti PRMT6 pAb (ATL-HPA059424) Datasheet (External Link)
Vendor Page Anti PRMT6 pAb (ATL-HPA059424)