Anti PRMT1 pAb (ATL-HPA072136)

Atlas Antibodies

Catalog No: ATL-HPA072136-100

• 
• 

Product Description

Protein Description: protein arginine methyltransferase 1
Gene Name: PRMT1
Alternative Gene Name: ANM1, HCP1, HRMT1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109324: 100%, ENSRNOG00000004090: 62%
Entrez Gene ID: 3276
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY
• Gene Sequence: VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY
• Gene ID - Mouse: ENSMUSG00000109324
• Gene ID - Rat: ENSRNOG00000004090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.