Description
Product Description
Protein Description: protein arginine methyltransferase 1
Gene Name: PRMT1
Alternative Gene Name: ANM1, HCP1, HRMT1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109324: 100%, ENSRNOG00000004090: 62%
Entrez Gene ID: 3276
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRMT1
Alternative Gene Name: ANM1, HCP1, HRMT1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109324: 100%, ENSRNOG00000004090: 62%
Entrez Gene ID: 3276
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY |
Gene Sequence | VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY |
Gene ID - Mouse | ENSMUSG00000109324 |
Gene ID - Rat | ENSRNOG00000004090 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRMT1 pAb (ATL-HPA072136) | |
Datasheet | Anti PRMT1 pAb (ATL-HPA072136) Datasheet (External Link) |
Vendor Page | Anti PRMT1 pAb (ATL-HPA072136) at Atlas Antibodies |
Documents & Links for Anti PRMT1 pAb (ATL-HPA072136) | |
Datasheet | Anti PRMT1 pAb (ATL-HPA072136) Datasheet (External Link) |
Vendor Page | Anti PRMT1 pAb (ATL-HPA072136) |