Description
Product Description
Protein Description: protein kinase C, theta
Gene Name: PRKCQ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026778: 96%, ENSRNOG00000019057: 96%
Entrez Gene ID: 5588
Uniprot ID: Q04759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRKCQ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026778: 96%, ENSRNOG00000019057: 96%
Entrez Gene ID: 5588
Uniprot ID: Q04759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK |
Gene Sequence | SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK |
Gene ID - Mouse | ENSMUSG00000026778 |
Gene ID - Rat | ENSRNOG00000019057 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRKCQ pAb (ATL-HPA065279) | |
Datasheet | Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link) |
Vendor Page | Anti PRKCQ pAb (ATL-HPA065279) at Atlas Antibodies |
Documents & Links for Anti PRKCQ pAb (ATL-HPA065279) | |
Datasheet | Anti PRKCQ pAb (ATL-HPA065279) Datasheet (External Link) |
Vendor Page | Anti PRKCQ pAb (ATL-HPA065279) |