Description
Product Description
Protein Description: protein kinase cAMP-dependent type II regulatory subunit beta
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI |
Gene Sequence | LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI |
Gene ID - Mouse | ENSMUSG00000002997 |
Gene ID - Rat | ENSRNOG00000009079 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879) | |
Datasheet | Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link) |
Vendor Page | Anti PRKAR2B pAb (ATL-HPA063879) at Atlas Antibodies |
Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879) | |
Datasheet | Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link) |
Vendor Page | Anti PRKAR2B pAb (ATL-HPA063879) |