![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99232/178713/atl-hpa063879_anti-prkar2b-pab-atl-hpa063879_60375__02821.1681134252.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: protein kinase cAMP-dependent type II regulatory subunit beta
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 98%, ENSRNOG00000009079: 95%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI |
| Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879) | |
| Datasheet | Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link) |
| Vendor Page | Anti PRKAR2B pAb (ATL-HPA063879) at Atlas |
| Documents & Links for Anti PRKAR2B pAb (ATL-HPA063879) | |
| Datasheet | Anti PRKAR2B pAb (ATL-HPA063879) Datasheet (External Link) |
| Vendor Page | Anti PRKAR2B pAb (ATL-HPA063879) |