Protein Description: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Name: PRKAG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067713: 67%, ENSRNOG00000061499: 60%
Entrez Gene ID: 5571
Uniprot ID: P54619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRKAG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067713: 67%, ENSRNOG00000061499: 60%
Entrez Gene ID: 5571
Uniprot ID: P54619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | METVISSDSSPAVENEHPQETPESNNSVYT |
Documents & Links for Anti PRKAG1 pAb (ATL-HPA077805) | |
Datasheet | Anti PRKAG1 pAb (ATL-HPA077805) Datasheet (External Link) |
Vendor Page | Anti PRKAG1 pAb (ATL-HPA077805) at Atlas |
Documents & Links for Anti PRKAG1 pAb (ATL-HPA077805) | |
Datasheet | Anti PRKAG1 pAb (ATL-HPA077805) Datasheet (External Link) |
Vendor Page | Anti PRKAG1 pAb (ATL-HPA077805) |