Anti PRKAA1 pAb (ATL-HPA064946)

Atlas Antibodies

Catalog No: ATL-HPA064946-25

• 
• 

Product Description

Protein Description: protein kinase, AMP-activated, alpha 1 catalytic subunit
Gene Name: PRKAA1
Alternative Gene Name: AMPKa1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050697: 100%, ENSRNOG00000012799: 100%
Entrez Gene ID: 5562
Uniprot ID: Q13131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
• Gene Sequence: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
• Gene ID - Mouse: ENSMUSG00000050697
• Gene ID - Rat: ENSRNOG00000012799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.