Protein Description: protein kinase, AMP-activated, alpha 1 catalytic subunit
Gene Name: PRKAA1
Alternative Gene Name: AMPKa1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050697: 100%, ENSRNOG00000012799: 100%
Entrez Gene ID: 5562
Uniprot ID: Q13131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRKAA1
Alternative Gene Name: AMPKa1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050697: 100%, ENSRNOG00000012799: 100%
Entrez Gene ID: 5562
Uniprot ID: Q13131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA |
Documents & Links for Anti PRKAA1 pAb (ATL-HPA064946) | |
Datasheet | Anti PRKAA1 pAb (ATL-HPA064946) Datasheet (External Link) |
Vendor Page | Anti PRKAA1 pAb (ATL-HPA064946) at Atlas |
Documents & Links for Anti PRKAA1 pAb (ATL-HPA064946) | |
Datasheet | Anti PRKAA1 pAb (ATL-HPA064946) Datasheet (External Link) |
Vendor Page | Anti PRKAA1 pAb (ATL-HPA064946) |