Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064183-25

• 

Product Description

Protein Description: proteoglycan 3
Gene Name: PRG3
Alternative Gene Name: MBPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027072: 57%, ENSRNOG00000037908: 51%
Entrez Gene ID: 10394
Uniprot ID: Q9Y2Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQ
• Gene Sequence: LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQ
• Gene ID - Mouse: ENSMUSG00000027072
• Gene ID - Rat: ENSRNOG00000037908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.