Protein Description: proteoglycan 3
Gene Name: PRG3
Alternative Gene Name: MBPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027072: 57%, ENSRNOG00000037908: 51%
Entrez Gene ID: 10394
Uniprot ID: Q9Y2Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRG3
Alternative Gene Name: MBPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027072: 57%, ENSRNOG00000037908: 51%
Entrez Gene ID: 10394
Uniprot ID: Q9Y2Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESDPAALDKDFQ |
| Documents & Links for Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) | |
| Datasheet | Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) at Atlas |
| Documents & Links for Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) | |
| Datasheet | Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRG3 pAb (ATL-HPA064183 w/enhanced validation) |