Protein Description: peroxiredoxin 4
Gene Name: PRDX4
Alternative Gene Name: AOE37-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025289: 98%, ENSRNOG00000003763: 98%
Entrez Gene ID: 10549
Uniprot ID: Q13162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRDX4
Alternative Gene Name: AOE37-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025289: 98%, ENSRNOG00000003763: 98%
Entrez Gene ID: 10549
Uniprot ID: Q13162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL |
Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) | |
Datasheet | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) at Atlas |
Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) | |
Datasheet | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) |