Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)

Catalog No:
ATL-HPA067039-25
$395.00

Description

Product Description

Protein Description: peroxiredoxin 4
Gene Name: PRDX4
Alternative Gene Name: AOE37-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025289: 98%, ENSRNOG00000003763: 98%
Entrez Gene ID: 10549
Uniprot ID: Q13162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL
Gene Sequence HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL
Gene ID - Mouse ENSMUSG00000025289
Gene ID - Rat ENSRNOG00000003763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)
Datasheet Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)
Datasheet Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)

Product Description

Protein Description: peroxiredoxin 4
Gene Name: PRDX4
Alternative Gene Name: AOE37-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025289: 98%, ENSRNOG00000003763: 98%
Entrez Gene ID: 10549
Uniprot ID: Q13162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL
Gene Sequence HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL
Gene ID - Mouse ENSMUSG00000025289
Gene ID - Rat ENSRNOG00000003763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)
Datasheet Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)
Datasheet Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRDX4 pAb (ATL-HPA067039 w/enhanced validation)