Anti PRDM9 pAb (ATL-HPA059555)

Atlas Antibodies

Catalog No: ATL-HPA059555-25

• 

Product Description

Protein Description: PR domain containing 9
Gene Name: PRDM9
Alternative Gene Name: MSBP3, PFM6, ZNF899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051977: 63%, ENSRNOG00000021493: 66%
Entrez Gene ID: 56979
Uniprot ID: Q9NQV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG
• Gene Sequence: QELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPSARKLLQPENPCPG
• Gene ID - Mouse: ENSMUSG00000051977
• Gene ID - Rat: ENSRNOG00000021493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti PRDM9 pAb (ATL-HPA059555) – 1 Found

Hadziselimovic, Faruk; Cathomas, Gieri; Verkauskas, Gilvydas; Dasevicius, Darius; Stadler, Michael B. PRDM Histone Methyltransferase mRNA Levels Increase in Response to Curative Hormone Treatment for Cryptorchidism-Dependent Male Infertility. Genes. 2018;9(8)