Description
Product Description
Protein Description: PR/SET domain 10
Gene Name: PRDM10
Alternative Gene Name: KIAA1231, MGC131802, PFM7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042496: 99%, ENSRNOG00000007853: 99%
Entrez Gene ID: 56980
Uniprot ID: Q9NQV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRDM10
Alternative Gene Name: KIAA1231, MGC131802, PFM7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042496: 99%, ENSRNOG00000007853: 99%
Entrez Gene ID: 56980
Uniprot ID: Q9NQV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA |
Gene Sequence | LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA |
Gene ID - Mouse | ENSMUSG00000042496 |
Gene ID - Rat | ENSRNOG00000007853 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRDM10 pAb (ATL-HPA061749) | |
Datasheet | Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link) |
Vendor Page | Anti PRDM10 pAb (ATL-HPA061749) at Atlas Antibodies |
Documents & Links for Anti PRDM10 pAb (ATL-HPA061749) | |
Datasheet | Anti PRDM10 pAb (ATL-HPA061749) Datasheet (External Link) |
Vendor Page | Anti PRDM10 pAb (ATL-HPA061749) |