Anti PRDM10 pAb (ATL-HPA061749)

Atlas Antibodies

Catalog No: ATL-HPA061749-25

• 

Product Description

Protein Description: PR/SET domain 10
Gene Name: PRDM10
Alternative Gene Name: KIAA1231, MGC131802, PFM7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042496: 99%, ENSRNOG00000007853: 99%
Entrez Gene ID: 56980
Uniprot ID: Q9NQV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
• Gene Sequence: LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
• Gene ID - Mouse: ENSMUSG00000042496
• Gene ID - Rat: ENSRNOG00000007853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.