![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101473/181587/atl-hpa075427_anti-prdm1-pab-atl-hpa075427_63255__69586.1681137948.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: PR/SET domain 1
Gene Name: PRDM1
Alternative Gene Name: BLIMP1, PRDI-BF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038151: 88%, ENSRNOG00000000323: 91%
Entrez Gene ID: 639
Uniprot ID: O75626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRDM1
Alternative Gene Name: BLIMP1, PRDI-BF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038151: 88%, ENSRNOG00000000323: 91%
Entrez Gene ID: 639
Uniprot ID: O75626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN |
| Documents & Links for Anti PRDM1 pAb (ATL-HPA075427) | |
| Datasheet | Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link) |
| Vendor Page | Anti PRDM1 pAb (ATL-HPA075427) at Atlas |
| Documents & Links for Anti PRDM1 pAb (ATL-HPA075427) | |
| Datasheet | Anti PRDM1 pAb (ATL-HPA075427) Datasheet (External Link) |
| Vendor Page | Anti PRDM1 pAb (ATL-HPA075427) |