![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100709/180660/atl-hpa071115_anti-prcp-pab-atl-hpa071115_62328__52144.1681136803.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: prolylcarboxypeptidase
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK |
| Documents & Links for Anti PRCP pAb (ATL-HPA071115) | |
| Datasheet | Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link) |
| Vendor Page | Anti PRCP pAb (ATL-HPA071115) at Atlas |
| Documents & Links for Anti PRCP pAb (ATL-HPA071115) | |
| Datasheet | Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link) |
| Vendor Page | Anti PRCP pAb (ATL-HPA071115) |