Description
Product Description
Protein Description: prolylcarboxypeptidase
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK |
Gene Sequence | VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK |
Gene ID - Mouse | ENSMUSG00000061119 |
Gene ID - Rat | ENSRNOG00000010630 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PRCP pAb (ATL-HPA071115) | |
Datasheet | Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link) |
Vendor Page | Anti PRCP pAb (ATL-HPA071115) at Atlas Antibodies |
Documents & Links for Anti PRCP pAb (ATL-HPA071115) | |
Datasheet | Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link) |
Vendor Page | Anti PRCP pAb (ATL-HPA071115) |