Anti PRCP pAb (ATL-HPA071115)

Catalog No:
ATL-HPA071115-100
$596.00

Description

Product Description

Protein Description: prolylcarboxypeptidase
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
Gene Sequence VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
Gene ID - Mouse ENSMUSG00000061119
Gene ID - Rat ENSRNOG00000010630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRCP pAb (ATL-HPA071115)
Datasheet Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link)
Vendor Page Anti PRCP pAb (ATL-HPA071115) at Atlas Antibodies

Documents & Links for Anti PRCP pAb (ATL-HPA071115)
Datasheet Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link)
Vendor Page Anti PRCP pAb (ATL-HPA071115)

Product Description

Protein Description: prolylcarboxypeptidase
Gene Name: PRCP
Alternative Gene Name: HUMPCP, PCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061119: 73%, ENSRNOG00000010630: 74%
Entrez Gene ID: 5547
Uniprot ID: P42785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
Gene Sequence VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
Gene ID - Mouse ENSMUSG00000061119
Gene ID - Rat ENSRNOG00000010630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PRCP pAb (ATL-HPA071115)
Datasheet Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link)
Vendor Page Anti PRCP pAb (ATL-HPA071115) at Atlas Antibodies

Documents & Links for Anti PRCP pAb (ATL-HPA071115)
Datasheet Anti PRCP pAb (ATL-HPA071115) Datasheet (External Link)
Vendor Page Anti PRCP pAb (ATL-HPA071115)