Anti PRAME pAb (ATL-HPA068562)

Atlas Antibodies

Catalog No: ATL-HPA068562-25

• 

Product Description

Protein Description: preferentially expressed antigen in melanoma
Gene Name: PRAME
Alternative Gene Name: CT130, MAPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028591: 40%, ENSRNOG00000037035: 40%
Entrez Gene ID: 23532
Uniprot ID: P78395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTL
• Gene Sequence: VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTL
• Gene ID - Mouse: ENSMUSG00000028591
• Gene ID - Rat: ENSRNOG00000037035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.