Protein Description: protein phosphatase 6, regulatory subunit 1
Gene Name: PPP6R1
Alternative Gene Name: KIAA1115, SAP190, SAPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052296: 70%, ENSRNOG00000018090: 73%
Entrez Gene ID: 22870
Uniprot ID: Q9UPN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP6R1
Alternative Gene Name: KIAA1115, SAP190, SAPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052296: 70%, ENSRNOG00000018090: 73%
Entrez Gene ID: 22870
Uniprot ID: Q9UPN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPP |
| Documents & Links for Anti PPP6R1 pAb (ATL-HPA063681) | |
| Datasheet | Anti PPP6R1 pAb (ATL-HPA063681) Datasheet (External Link) |
| Vendor Page | Anti PPP6R1 pAb (ATL-HPA063681) at Atlas |
| Documents & Links for Anti PPP6R1 pAb (ATL-HPA063681) | |
| Datasheet | Anti PPP6R1 pAb (ATL-HPA063681) Datasheet (External Link) |
| Vendor Page | Anti PPP6R1 pAb (ATL-HPA063681) |