Anti PPP6R1 pAb (ATL-HPA063681)

Atlas Antibodies

Catalog No: ATL-HPA063681-25

• 

Product Description

Protein Description: protein phosphatase 6, regulatory subunit 1
Gene Name: PPP6R1
Alternative Gene Name: KIAA1115, SAP190, SAPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052296: 70%, ENSRNOG00000018090: 73%
Entrez Gene ID: 22870
Uniprot ID: Q9UPN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPP
• Gene Sequence: ATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPSTSVPASGAHQPPQTTEGEKSPEPLGLPQSQSAQALTPP
• Gene ID - Mouse: ENSMUSG00000052296
• Gene ID - Rat: ENSRNOG00000018090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.