Description
Product Description
Protein Description: protein phosphatase 2, regulatory subunit B'', alpha
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA |
Gene Sequence | FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA |
Gene ID - Mouse | ENSMUSG00000043154 |
Gene ID - Rat | ENSRNOG00000022999 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338) | |
Datasheet | Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link) |
Vendor Page | Anti PPP2R3A pAb (ATL-HPA065338) at Atlas Antibodies |
Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338) | |
Datasheet | Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link) |
Vendor Page | Anti PPP2R3A pAb (ATL-HPA065338) |