Protein Description: protein phosphatase 2, regulatory subunit B'', alpha
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP2R3A
Alternative Gene Name: PPP2R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043154: 93%, ENSRNOG00000022999: 89%
Entrez Gene ID: 5523
Uniprot ID: Q06190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA |
| Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338) | |
| Datasheet | Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link) |
| Vendor Page | Anti PPP2R3A pAb (ATL-HPA065338) at Atlas |
| Documents & Links for Anti PPP2R3A pAb (ATL-HPA065338) | |
| Datasheet | Anti PPP2R3A pAb (ATL-HPA065338) Datasheet (External Link) |
| Vendor Page | Anti PPP2R3A pAb (ATL-HPA065338) |