Description
Product Description
Protein Description: protein phosphatase 1, regulatory subunit 3G
Gene Name: PPP1R3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050423: 76%, ENSRNOG00000016222: 77%
Entrez Gene ID: 648791
Uniprot ID: B7ZBB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R3G
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050423: 76%, ENSRNOG00000016222: 77%
Entrez Gene ID: 648791
Uniprot ID: B7ZBB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRY |
Gene Sequence | DAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRY |
Gene ID - Mouse | ENSMUSG00000050423 |
Gene ID - Rat | ENSRNOG00000016222 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PPP1R3G pAb (ATL-HPA056393) | |
Datasheet | Anti PPP1R3G pAb (ATL-HPA056393) Datasheet (External Link) |
Vendor Page | Anti PPP1R3G pAb (ATL-HPA056393) at Atlas Antibodies |
Documents & Links for Anti PPP1R3G pAb (ATL-HPA056393) | |
Datasheet | Anti PPP1R3G pAb (ATL-HPA056393) Datasheet (External Link) |
Vendor Page | Anti PPP1R3G pAb (ATL-HPA056393) |