Protein Description: protein phosphatase 1 regulatory subunit 3A
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 45%, ENSRNOG00000059350: 49%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 45%, ENSRNOG00000059350: 49%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG |
| Documents & Links for Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) | |
| Datasheet | Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) at Atlas |
| Documents & Links for Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) | |
| Datasheet | Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R3A pAb (ATL-HPA073138 w/enhanced validation) |