Description
Product Description
Protein Description: protein phosphatase 1 regulatory subunit 3A
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 46%, ENSRNOG00000059350: 52%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 46%, ENSRNOG00000059350: 52%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS |
Gene Sequence | CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS |
Gene ID - Mouse | ENSMUSG00000042717 |
Gene ID - Rat | ENSRNOG00000059350 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) | |
Datasheet | Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) | |
Datasheet | Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation) |