Anti PPP1R3A pAb (ATL-HPA070440 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA070440-25

• 

Product Description

Protein Description: protein phosphatase 1 regulatory subunit 3A
Gene Name: PPP1R3A
Alternative Gene Name: GM, PPP1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042717: 46%, ENSRNOG00000059350: 52%
Entrez Gene ID: 5506
Uniprot ID: Q16821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS
• Gene Sequence: CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS
• Gene ID - Mouse: ENSMUSG00000042717
• Gene ID - Rat: ENSRNOG00000059350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.