Protein Description: protein phosphatase 1 regulatory subunit 36
Gene Name: PPP1R36
Alternative Gene Name: C14orf50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052221: 73%, ENSRNOG00000038480: 78%
Entrez Gene ID: 145376
Uniprot ID: Q96LQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R36
Alternative Gene Name: C14orf50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052221: 73%, ENSRNOG00000038480: 78%
Entrez Gene ID: 145376
Uniprot ID: Q96LQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLGLAVPDKHHMCCGKEKISDTQK |
| Documents & Links for Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) | |
| Datasheet | Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) at Atlas |
| Documents & Links for Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) | |
| Datasheet | Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R36 pAb (ATL-HPA077492 w/enhanced validation) |