Protein Description: protein phosphatase 1 regulatory subunit 17
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 81%, ENSRNOG00000012235: 81%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R17
Alternative Gene Name: C7orf16, GSBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002930: 81%, ENSRNOG00000012235: 81%
Entrez Gene ID: 10842
Uniprot ID: O96001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS |
| Gene ID - Mouse | ENSMUSG00000002930 |
| Gene ID - Rat | ENSMUSG00000002930 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123) | |
| Datasheet | Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link) |
| Vendor Page | Anti PPP1R17 pAb (ATL-HPA073123) at Atlas |
| Documents & Links for Anti PPP1R17 pAb (ATL-HPA073123) | |
| Datasheet | Anti PPP1R17 pAb (ATL-HPA073123) Datasheet (External Link) |
| Vendor Page | Anti PPP1R17 pAb (ATL-HPA073123) |