![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line A-549](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/91824/167415/atl-hpa042097_anti-ppp1r14a-pab-atl-hpa042097-wenhanced-validation_49062__26417.1681120440.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line A-549")
Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 14A
Gene Name: PPP1R14A
Alternative Gene Name: CPI-17, PPP1INL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037166: 89%, ENSRNOG00000020676: 92%
Entrez Gene ID: 94274
Uniprot ID: Q96A00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R14A
Alternative Gene Name: CPI-17, PPP1INL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037166: 89%, ENSRNOG00000020676: 92%
Entrez Gene ID: 94274
Uniprot ID: Q96A00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR |
| Documents & Links for Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) | |
| Datasheet | Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) at Atlas |
| Documents & Links for Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) | |
| Datasheet | Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PPP1R14A pAb (ATL-HPA042097 w/enhanced validation) |