Description
Product Description
Protein Description: protein phosphatase 1, regulatory subunit 10
Gene Name: PPP1R10
Alternative Gene Name: CAT53, FB19, p99, PNUTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039220: 96%, ENSRNOG00000059268: 97%
Entrez Gene ID: 5514
Uniprot ID: Q96QC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PPP1R10
Alternative Gene Name: CAT53, FB19, p99, PNUTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039220: 96%, ENSRNOG00000059268: 97%
Entrez Gene ID: 5514
Uniprot ID: Q96QC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV |
Gene Sequence | LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV |
Gene ID - Mouse | ENSMUSG00000039220 |
Gene ID - Rat | ENSRNOG00000059268 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) | |
Datasheet | Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) | |
Datasheet | Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPP1R10 pAb (ATL-HPA056756 w/enhanced validation) |